RRAD (NM_001128850) Human Recombinant Protein

RRAD protein,

Recombinant protein of human Ras-related associated with diabetes (RRAD), transcript variant 1

Product Info Summary

SKU: PROTP55042
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RRAD (NM_001128850) Human Recombinant Protein

View all RRAD recombinant proteins

SKU/Catalog Number

PROTP55042

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Ras-related associated with diabetes (RRAD), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RRAD (NM_001128850) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP55042)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.1 kDa

Amino Acid Sequence

MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRLDWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSKSCHDLSVL

Validation Images & Assay Conditions

Gene/Protein Information For RRAD (Source: Uniprot.org, NCBI)

Gene Name

RRAD

Full Name

GTP-binding protein RAD

Weight

33.1 kDa

Superfamily

small GTPase superfamily

Alternative Names

RAD1; RADGTP-binding protein RAD; RAS (RAD and GEM) like GTP binding 3; Ras associated with diabetes; Ras-related associated with diabetes; REM3 RRAD RAD, RAD1, REM3 RRAD, Ras related glycolysis inhibitor and calcium channel regulator GTP-binding protein RAD|RAS (RAD and GEM) like GTP binding 3|RRAD, Ras related glycolysis inihibitor and calcium channel regulator|Ras-related associated with diabetes|ras associated with diabetes

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RRAD, check out the RRAD Infographic

RRAD infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RRAD: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP55042

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RRAD (NM_001128850) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RRAD (NM_001128850) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RRAD (NM_001128850) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP55042
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.