REG1 beta (REG1B) (NM_006507) Human Recombinant Protein

REG1B protein,

Recombinant protein of human regenerating islet-derived 1 beta (REG1B)

Product Info Summary

SKU: PROTP48304
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

REG1 beta (REG1B) (NM_006507) Human Recombinant Protein

View all REG1B recombinant proteins

SKU/Catalog Number

PROTP48304

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human regenerating islet-derived 1 beta (REG1B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

REG1 beta (REG1B) (NM_006507) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP48304)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.2 kDa

Amino Acid Sequence

MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN

Validation Images & Assay Conditions

Gene/Protein Information For REG1B (Source: Uniprot.org, NCBI)

Gene Name

REG1B

Full Name

Lithostathine-1-beta

Weight

16.2 kDa

Alternative Names

Lithostathine 1 beta; lithostathine-1-beta; Pancreatic stone protein 2; pancreatic threadprotein); PSPS2; PSPS2PSP-2; Reg1B; regenerating islet-derived 1 beta; Regenerating islet-derived protein 1-beta; Regenerating protein I beta; REGH; REGLREG-1-beta; secretory pancreatic stone protein 2 REG1B PSPS2, REGH, REGI-BETA, REGL regenerating family member 1 beta lithostathine-1-beta|PSP-2|REG-1-beta|pancreatic stone protein 2|regenerating islet-derived 1 beta (pancreatic stone protein, pancreatic thread protein)|regenerating islet-derived protein 1-beta|regenerating protein I beta|secretory pancreatic stone protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on REG1B, check out the REG1B Infographic

REG1B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for REG1B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP48304

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used REG1 beta (REG1B) (NM_006507) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For REG1 beta (REG1B) (NM_006507) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for REG1 beta (REG1B) (NM_006507) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP48304
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.