Product Info Summary
SKU: | PROTP06400 |
---|---|
Size: | 10ug, 50ug, 1mg |
Origin Species: | Human |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
RB1 Retinoblastoma Associated Protein Human Recombinant Protein
View all RB1 recombinant proteins
SKU/Catalog Number
PROTP06400
Size
10ug, 50ug, 1mg
Description
Retinoblastoma Human Recombinant fused with 6X His tag produced in E. coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16.5 kDa. The Retinoblastoma is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized Retinoblastoma although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Retinoblastoma should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Cite This Product
RB1 Retinoblastoma Associated Protein Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP06400)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The RB1 (1 mg/ml) was lyophilized after extensive dialyses against 1xPBS pH-7.4.
Purity
Greater than 95.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Reconstitution
It is recommended to reconstitute the lyophilized Retinoblastoma in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSK HLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized Retinoblastoma in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For RB1 (Source: Uniprot.org, NCBI)
Gene Name
RB1
Full Name
Retinoblastoma-associated protein
Weight
Superfamily
retinoblastoma protein (RB) family
Alternative Names
OSRC; osteosarcoma; p105-Rb; pp110; pRb; RB; RB1; retinoblastoma 1; retinoblastoma suspectibility protein; retinoblastoma-associated protein RB1 OSRC, PPP1R130, RB, p105-Rb, p110-RB1, pRb, pp110 RB transcriptional corepressor 1 retinoblastoma-associated protein|GOS563 exon 17 substitution mutation causes premature stop|exon 17 tumor GOS561 substitution mutation causes premature stop|prepro-retinoblastoma-associated protein|protein phosphatase 1, regulatory subunit 130|retinoblastoma 1|retinoblastoma suspectibility protein
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on RB1, check out the RB1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for RB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For RB1 Retinoblastoma Associated Protein Human Recombinant Protein (PROTP06400)
Hello CJ!
No publications found for PROTP06400
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used RB1 Retinoblastoma Associated Protein Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For RB1 Retinoblastoma Associated Protein Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question