RB1 Retinoblastoma Associated Protein Human Recombinant Protein

RB1 protein, Human

Retinoblastoma Human Recombinant fused with 6X His tag produced in E. coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16.5 kDa. The Retinoblastoma is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTP06400
Size: 10ug, 50ug, 1mg
Origin Species: Human
Source: Escherichia coli

Product Name

RB1 Retinoblastoma Associated Protein Human Recombinant Protein

View all RB1 recombinant proteins

SKU/Catalog Number

PROTP06400

Size

10ug, 50ug, 1mg

Description

Retinoblastoma Human Recombinant fused with 6X His tag produced in E. coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16.5 kDa. The Retinoblastoma is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized Retinoblastoma although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Retinoblastoma should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Cite This Product

RB1 Retinoblastoma Associated Protein Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP06400)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

The RB1 (1 mg/ml) was lyophilized after extensive dialyses against 1xPBS pH-7.4.

Purity

Greater than 95.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.

Predicted MW

106.159kDa

Reconstitution

It is recommended to reconstitute the lyophilized Retinoblastoma in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSK HLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH

Reconstitution

It is recommended to reconstitute the lyophilized Retinoblastoma in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For RB1 (Source: Uniprot.org, NCBI)

Gene Name

RB1

Full Name

Retinoblastoma-associated protein

Weight

106.159kDa

Superfamily

retinoblastoma protein (RB) family

Alternative Names

RB; OSRC; RB-1; RB1; p105-Rb; OSTEOSARCOMA; RETINOBLASTOMA-RELATED;PP110; Retinoblastoma-associated protein RB1 OSRC, PPP1R130, RB, p105-Rb, p110-RB1, pRb, pp110 RB transcriptional corepressor 1 retinoblastoma-associated protein|GOS563 exon 17 substitution mutation causes premature stop|exon 17 tumor GOS561 substitution mutation causes premature stop|prepro-retinoblastoma-associated protein|protein phosphatase 1, regulatory subunit 130|retinoblastoma 1|retinoblastoma suspectibility protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RB1, check out the RB1 Infographic

RB1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP06400

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RB1 Retinoblastoma Associated Protein Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RB1 Retinoblastoma Associated Protein Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RB1 Retinoblastoma Associated Protein Human Recombinant Protein

Size

Total: $250

SKU:PROTP06400

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTP06400
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.