RASL10A (NM_006477) Human Recombinant Protein

RASL10A protein,

Recombinant protein of human RAS-like, family 10, member A (RASL10A), transcript variant 1

Product Info Summary

SKU: PROTQ92737
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RASL10A (NM_006477) Human Recombinant Protein

View all RASL10A recombinant proteins

SKU/Catalog Number

PROTQ92737

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RAS-like, family 10, member A (RASL10A), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RASL10A (NM_006477) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ92737)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.4 kDa

Amino Acid Sequence

MGGSLRVAVLGAPGVGKTAIIRQFVFGDYPERHRPTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRPAGAPEAPILVVGNKRDRQRLRFGPRRALAALVRRGWRCGYLECSAKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLM

Validation Images & Assay Conditions

Gene/Protein Information For RASL10A (Source: Uniprot.org, NCBI)

Gene Name

RASL10A

Full Name

Ras-like protein family member 10A

Weight

22.4 kDa

Superfamily

small GTPase superfamily

Alternative Names

ras-like protein family member 10A; RAS-like, family 10, member A; RAS-related on chromosome 22; Ras-related protein on chromosome 22; RRP22Ras-like protein RRP22 RASL10A RRP22 RAS like family 10 member A ras-like protein family member 10A|ras-like protein RRP22|ras-related protein on chromosome 22

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RASL10A, check out the RASL10A Infographic

RASL10A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RASL10A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ92737

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RASL10A (NM_006477) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RASL10A (NM_006477) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RASL10A (NM_006477) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ92737
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.