RAE1 (NM_001015885) Human Recombinant Protein

RAE1 protein,

Recombinant protein of human RAE1 RNA export 1 homolog (S. pombe) (RAE1), transcript variant 2

Product Info Summary

SKU: PROTP78406
Size: 20 µg
Source: HEK293T

Product Name

RAE1 (NM_001015885) Human Recombinant Protein

View all RAE1 recombinant proteins

SKU/Catalog Number

PROTP78406

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RAE1 RNA export 1 homolog (S. pombe) (RAE1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RAE1 (NM_001015885) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP78406)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

40.8 kDa

Amino Acid Sequence

MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK

Validation Images & Assay Conditions

Gene/Protein Information For RAE1 (Source: Uniprot.org, NCBI)

Gene Name

RAE1

Full Name

mRNA export factor

Weight

40.8 kDa

Superfamily

WD repeat rae1 family

Alternative Names

dJ481F12.3; dJ800J21.1; FLJ30608; homolog of yeast Rae1 (Bharathi) mRNA-associated protein of 41 kDa (Kraemer); MGC117333; MGC126076; MGC126077; MIG14; migration-inducing gene 14; Mnrp41; mRNA export factor; mRNA export protein; mRNA-associated protein mrnp 41; mRNA-binding protein, 41-kD; MRNP41; RAE1 (RNA export 1, S.pombe) homolog; Rae1 protein homolog; RAE1 RNA export 1 homolog (S. pombe) RAE1 Gle2, MIG14, MRNP41, Mnrp41, dJ481F12.3, dJ800J21.1 ribonucleic acid export 1 mRNA export factor|RAE1 RNA export 1 homolog|homolog of yeast Rae1 (Bharathi) mRNA-associated protein of 41 kDa (Kraemer)|mRNA export protein|mRNA-associated protein MRNP 41|mRNA-binding protein, 41-kD|migration-inducing gene 14|rae1 protein homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RAE1, check out the RAE1 Infographic

RAE1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RAE1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used RAE1 (NM_001015885) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RAE1 (NM_001015885) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RAE1 (NM_001015885) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP78406
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.