RAB28 (NM_001017979) Human Recombinant Protein

RAB28 protein,

Recombinant protein of human RAB28, member RAS oncogene family (RAB28), transcript variant 1

Product Info Summary

SKU: PROTP51157
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RAB28 (NM_001017979) Human Recombinant Protein

View all RAB28 recombinant proteins

SKU/Catalog Number

PROTP51157

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RAB28, member RAS oncogene family (RAB28), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RAB28 (NM_001017979) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP51157)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.7 kDa

Amino Acid Sequence

MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTVNPPRSSMCAVQ

Validation Images & Assay Conditions

Gene/Protein Information For RAB28 (Source: Uniprot.org, NCBI)

Gene Name

RAB28

Full Name

Ras-related protein Rab-28

Weight

24.7 kDa

Superfamily

small GTPase superfamily

Alternative Names

MGC41862; RAB28, member RAS oncogene family; ras-related protein Rab-28 RAB28 CORD18 RAB28, member RAS oncogene family ras-related protein Rab-28

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RAB28, check out the RAB28 Infographic

RAB28 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RAB28: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP51157

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RAB28 (NM_001017979) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RAB28 (NM_001017979) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RAB28 (NM_001017979) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP51157
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.