QDPR (NM_000320) Human Recombinant Protein

QDPR protein,

Product Info Summary

SKU: PROTP09417
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

QDPR (NM_000320) Human Recombinant Protein

View all QDPR recombinant proteins

SKU/Catalog Number

PROTP09417

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human quinoid dihydropteridine reductase (QDPR)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

QDPR (NM_000320) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09417)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.6 kDa

Amino Acid Sequence

MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF

Validation Images & Assay Conditions

Gene/Protein Information For QDPR (Source: Uniprot.org, NCBI)

Gene Name

QDPR

Full Name

Dihydropteridine reductase

Weight

25.6 kDa

Superfamily

short-chain dehydrogenases/reductases (SDR) family

Alternative Names

DHPR member 1; DHPR; HDHPR; PKU2; QDPR; quinoid dihydropteridine reductaseFLJ42391; SDR33C1 QDPR DHPR, HDHPR, PKU2, SDR33C1 quinoid dihydropteridine reductase dihydropteridine reductase|6,7-dihydropteridine reductase|short chain dehydrogenase/reductase family 33C member 1|testis secretory sperm-binding protein Li 236P

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on QDPR, check out the QDPR Infographic

QDPR infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for QDPR: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP09417

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used QDPR (NM_000320) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For QDPR (NM_000320) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for QDPR (NM_000320) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP09417
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.