PTPN20B (PTPN20) (NM_001042363) Human Recombinant Protein

Ptpn20 protein,

Purified recombinant protein of Homo sapiens protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 8

Product Info Summary

SKU: PROTQ4JDL3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PTPN20B (PTPN20) (NM_001042363) Human Recombinant Protein

View all Ptpn20 recombinant proteins

SKU/Catalog Number

PROTQ4JDL3

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 8

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PTPN20B (PTPN20) (NM_001042363) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ4JDL3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

39 kDa

Amino Acid Sequence

MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQTAIKDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGEEYFYIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD

Validation Images & Assay Conditions

Gene/Protein Information For Ptpn20 (Source: Uniprot.org, NCBI)

Gene Name

Ptpn20

Full Name

Tyrosine-protein phosphatase non-receptor type 20

Weight

39 kDa

Superfamily

protein-tyrosine phosphatase family

Alternative Names

protein tyrosine phosphatase, non-receptor type 20; bA42B19.1; protein tyrosine phosphatase, non-receptor type 20B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Ptpn20, check out the Ptpn20 Infographic

Ptpn20 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Ptpn20: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ4JDL3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PTPN20B (PTPN20) (NM_001042363) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PTPN20B (PTPN20) (NM_001042363) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PTPN20B (PTPN20) (NM_001042363) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ4JDL3
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.