PRR20D (NM_001130406) Human Recombinant Protein

PRR20D protein,

Purified recombinant protein of Homo sapiens FLJ40296 protein family member (LOC729246)

Product Info Summary

SKU: PROTP86480
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PRR20D (NM_001130406) Human Recombinant Protein

View all PRR20D recombinant proteins

SKU/Catalog Number

PROTP86480

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens FLJ40296 protein family member (LOC729246)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PRR20D (NM_001130406) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP86480)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.1 kDa

Amino Acid Sequence

MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQPPARPESPPPAERGRRRGGSRRPGRGRGRRAGPRGDAGQRQGAEGLMAPDVHIQLDHHGEPGHQGEPEITETAAFSLSETGPPPGTVQEGPGPDVAQPELGFQEPPAAPGPQAVDWQPVLTLYPCIGFRALGDSAVLQVIQTPQGTYVQGVPVFLTDIAY

Validation Images & Assay Conditions

Gene/Protein Information For PRR20D (Source: Uniprot.org, NCBI)

Gene Name

PRR20D

Full Name

Proline-rich protein 20D

Weight

23.1 kDa

Superfamily

PRR20 family

Alternative Names

Proline-rich protein 20D PRR20D PRR20, PRR20A, PRR20B, PRR20C, PRR20E proline rich 20D proline-rich protein 20D|FLJ40296 protein family member|Proline-rich protein 20A|Proline-rich protein 20B|Proline-rich protein 20C|Proline-rich protein 20E

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRR20D, check out the PRR20D Infographic

PRR20D infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRR20D: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP86480

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PRR20D (NM_001130406) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PRR20D (NM_001130406) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PRR20D (NM_001130406) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP86480
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.