PRPSAP2 (NM_002767) Human Recombinant Protein

PRPSAP2 protein,

Product Info Summary

SKU: PROTO60256
Size: 20 µg
Source: HEK293T

Product Name

PRPSAP2 (NM_002767) Human Recombinant Protein

View all PRPSAP2 recombinant proteins

SKU/Catalog Number

PROTO60256

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phosphoribosyl pyrophosphate synthetase-associated protein 2 (PRPSAP2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PRPSAP2 (NM_002767) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO60256)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

40.7 kDa

Amino Acid Sequence

MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDD

Validation Images & Assay Conditions

Gene/Protein Information For PRPSAP2 (Source: Uniprot.org, NCBI)

Gene Name

PRPSAP2

Full Name

Phosphoribosyl pyrophosphate synthase-associated protein 2

Weight

40.7 kDa

Superfamily

ribose-phosphate pyrophosphokinase family

Alternative Names

MGC117304; MGC126719; MGC126721; PAP4141 kDa phosphoribosypyrophosphate synthetase-associated protein; phosphoribosyl pyrophosphate synthase-associated protein 2; phosphoribosyl pyrophosphate synthetase-associated protein 2; PRPP synthase-associated protein 2 PRPSAP2 PAP41 phosphoribosyl pyrophosphate synthetase associated protein 2 phosphoribosyl pyrophosphate synthase-associated protein 2|41 kDa phosphoribosypyrophosphate synthetase-associated protein|PRPP synthase-associated protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRPSAP2, check out the PRPSAP2 Infographic

PRPSAP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRPSAP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO60256

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PRPSAP2 (NM_002767) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PRPSAP2 (NM_002767) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PRPSAP2 (NM_002767) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO60256
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.