PRPS1 (NM_002764) Human Recombinant Protein

PRPS1 protein,

Product Info Summary

SKU: PROTP60891
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PRPS1 (NM_002764) Human Recombinant Protein

View all PRPS1 recombinant proteins

SKU/Catalog Number

PROTP60891

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phosphoribosyl pyrophosphate synthetase 1 (PRPS1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PRPS1 (NM_002764) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP60891)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.7 kDa

Amino Acid Sequence

MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL

Validation Images & Assay Conditions

Gene/Protein Information For PRPS1 (Source: Uniprot.org, NCBI)

Gene Name

PRPS1

Full Name

Ribose-phosphate pyrophosphokinase 1

Weight

34.7 kDa

Superfamily

ribose-phosphate pyrophosphokinase family

Alternative Names

CMTX5ARTS; deafness, X-linked 2, perceptive, congenital; DFN2; DFNX1KIAA0967; dJ1070B1.2 (phosphoribosyl pyrophosphate synthetase 1); EC 2.7.6.1; Phosphoribosyl pyrophosphate synthase I; phosphoribosyl pyrophosphate synthetase 1; PPRibP; PRSI; PRS-I; ribose-phosphate diphosphokinase 1; ribose-phosphate pyrophosphokinase 1 PRPS1 ARTS, CMTX5, DFN2, DFNX1, PPRibP, PRS-I, PRSI phosphoribosyl pyrophosphate synthetase 1 ribose-phosphate pyrophosphokinase 1|dJ1070B1.2 (phosphoribosyl pyrophosphate synthetase 1)|deafness 2, perceptive, congenital|deafness, X-linked 2, perceptive, congenital|phosphoribosyl pyrophosphate synthase I|ribose-phosphate diphosphokinase 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRPS1, check out the PRPS1 Infographic

PRPS1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRPS1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP60891

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PRPS1 (NM_002764) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PRPS1 (NM_002764) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PRPS1 (NM_002764) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP60891
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.