Proteasome subunit alpha type 6 (PSMA6) (NM_002791) Human Recombinant Protein

Proteasome 20S alpha 6 protein,

Product Info Summary

SKU: PROTP60900
Size: 20 µg
Source: HEK293T

Product Name

Proteasome subunit alpha type 6 (PSMA6) (NM_002791) Human Recombinant Protein

View all Proteasome 20S alpha 6 recombinant proteins

SKU/Catalog Number

PROTP60900

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 6 (PSMA6)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Proteasome subunit alpha type 6 (PSMA6) (NM_002791) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP60900)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.2 kDa

Amino Acid Sequence

MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD

Validation Images & Assay Conditions

Gene/Protein Information For PSMA6 (Source: Uniprot.org, NCBI)

Gene Name

PSMA6

Full Name

Proteasome subunit alpha type-6

Weight

27.2 kDa

Superfamily

peptidase T1A family

Alternative Names

EC 3.4.25.1; IOTA; Macropain iota chain; macropain subunit iota; MGC22756; MGC2333; MGC23846; Multicatalytic endopeptidase complex iota chain; P27K; p27KPROS-27; PROS2727 kDa prosomal protein; prosomal P27K protein; proteasome (prosome, macropain) subunit, alpha type, 6; Proteasome iota chain; proteasome subunit alpha type-6; proteasome subunit iota PSMA6 IOTA, PROS27, p27K proteasome 20S subunit alpha 6 proteasome subunit alpha type-6|27 kDa prosomal protein|PROS-27|macropain iota chain|macropain subunit iota|multicatalytic endopeptidase complex iota chain|prosomal P27K protein|proteasome (prosome, macropain) subunit, alpha type, 6|proteasome iota chain|proteasome subunit alpha 6|proteasome subunit alpha1|proteasome subunit iota|testicular secretory protein Li 44

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PSMA6, check out the PSMA6 Infographic

PSMA6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PSMA6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP60900

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Proteasome subunit alpha type 6 (PSMA6) (NM_002791) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Proteasome subunit alpha type 6 (PSMA6) (NM_002791) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Proteasome subunit alpha type 6 (PSMA6) (NM_002791) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP60900
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.