Product Info Summary
SKU: | PROTP16471 |
---|---|
Size: | 5ug, 20ug, 1mg |
Origin Species: | Human |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
PRL-R Prolactin Soluble Receptor Human Recombinant Protein
View all Prolactin R recombinant proteins
SKU/Catalog Number
PROTP16471
Size
5ug, 20ug, 1mg
Description
Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E. coli is a non-glycosylated, polypeptide chain containing 210 amino acids and having a molecular mass of 23.97 kDa. The Prolactin Receptor is purified by proprietary chromatographic techniques according to Bignon et al. (1994) JBC 269; 3318-24 and tested according to Gertler et al. (1996) JBC 271; 24482-91.
Storage & Handling
Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles as they cause oligomerization of the protein.
Cite This Product
PRL-R Prolactin Soluble Receptor Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP16471)
Form
Sterile filtered white lyophilized powder.
Formulation
The Prolactin Receptor was lyophilized from a concentrated (0.4mg/ml) solution with 0.0045mM NaHCO3.
Purity
Greater than 97.0% as determined by (a) Analysis by SEC-HPLC, (b) Analysis by SDS-PAGE, and (c) Gel filtration at pH 8 under non denaturative conditions.
Reconstitution
It is recommended to reconstitute the lyophilized PRLR in sterile 18M-cm H2O not less than 100µg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCH FGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYL WIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVR CKPDHGYWSAWSPATFIQIPSDFTMNDTTVW
Biological Activity
Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio.
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized PRLR in sterile 18M-cm H2O not less than 100µg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
![recombinant protein thumbnail_1 recombinant protein thumbnail_1](https://www.bosterbio.com/media/catalog/product/r/e/recombinant-protein-thumbnail_1.png)
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For PRLR (Source: Uniprot.org, NCBI)
Gene Name
PRLR
Full Name
Prolactin receptor
Weight
Superfamily
type I cytokine receptor family
Alternative Names
delta 4-delta 7/11 truncated prolactin receptor; delta 4-SF1b truncated prolactin receptor; hPRL receptor; hPRLrI; PRLR; PRL-R; Prolactin R; prolactin receptor delta 7/11; prolactin receptor; ProlactinR; secreted prolactin binding protein PRLR HPRL, MFAB, RI-PRLR, hPRLrI prolactin receptor prolactin receptor|hPRL receptor|secreted prolactin binding protein
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on PRLR, check out the PRLR Infographic
![PRLR infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PRLR: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For PRL-R Prolactin Soluble Receptor Human Recombinant Protein (PROTP16471)
Hello CJ!
No publications found for PROTP16471
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used PRL-R Prolactin Soluble Receptor Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For PRL-R Prolactin Soluble Receptor Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question