PRL-R Prolactin Soluble Receptor Human Recombinant Protein

Prolactin R protein, Human

Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E. coli is a non-glycosylated, polypeptide chain containing 210 amino acids and having a molecular mass of 23.97 kDa. The Prolactin Receptor is purified by proprietary chromatographic techniques according to Bignon et al. (1994) JBC 269; 3318-24 and tested according to Gertler et al. (1996) JBC 271; 24482-91.

Product Info Summary

SKU: PROTP16471
Size: 5ug, 20ug, 1mg
Origin Species: Human
Source: Escherichia coli

Customers Who Bought This Also Bought

Product Name

PRL-R Prolactin Soluble Receptor Human Recombinant Protein

View all Prolactin R recombinant proteins

SKU/Catalog Number

PROTP16471

Size

5ug, 20ug, 1mg

Description

Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E. coli is a non-glycosylated, polypeptide chain containing 210 amino acids and having a molecular mass of 23.97 kDa. The Prolactin Receptor is purified by proprietary chromatographic techniques according to Bignon et al. (1994) JBC 269; 3318-24 and tested according to Gertler et al. (1996) JBC 271; 24482-91.

Storage & Handling

Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles as they cause oligomerization of the protein.

Cite This Product

PRL-R Prolactin Soluble Receptor Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP16471)

Form

Sterile filtered white lyophilized powder.

Formulation

The Prolactin Receptor was lyophilized from a concentrated (0.4mg/ml) solution with 0.0045mM NaHCO3.

Purity

Greater than 97.0% as determined by (a) Analysis by SEC-HPLC, (b) Analysis by SDS-PAGE, and (c) Gel filtration at pH 8 under non denaturative conditions.

Reconstitution

It is recommended to reconstitute the lyophilized PRLR in sterile 18M-cm H2O not less than 100µg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCH FGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYL WIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVR CKPDHGYWSAWSPATFIQIPSDFTMNDTTVW

Biological Activity

Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio.

Reconstitution

It is recommended to reconstitute the lyophilized PRLR in sterile 18M-cm H2O not less than 100µg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For PRLR (Source: Uniprot.org, NCBI)

Gene Name

PRLR

Full Name

Prolactin receptor

Weight

Superfamily

type I cytokine receptor family

Alternative Names

delta 4-delta 7/11 truncated prolactin receptor; delta 4-SF1b truncated prolactin receptor; hPRL receptor; hPRLrI; PRLR; PRL-R; Prolactin R; prolactin receptor delta 7/11; prolactin receptor; ProlactinR; secreted prolactin binding protein PRLR HPRL, MFAB, RI-PRLR, hPRLrI prolactin receptor prolactin receptor|hPRL receptor|secreted prolactin binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRLR, check out the PRLR Infographic

PRLR infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRLR: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP16471

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PRL-R Prolactin Soluble Receptor Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PRL-R Prolactin Soluble Receptor Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PRL-R Prolactin Soluble Receptor Human Recombinant Protein

Size

Total: $250

SKU:PROTP16471

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTP16471
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.