Product Info Summary
SKU: | PROTP16471 |
---|---|
Size: | 5ug, 20ug, 1mg |
Origin Species: | Human |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
PRL-R Prolactin Soluble Receptor Human Recombinant Protein
View all Prolactin R recombinant proteins
SKU/Catalog Number
PROTP16471
Size
5ug, 20ug, 1mg
Description
Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E. coli is a non-glycosylated, polypeptide chain containing 210 amino acids and having a molecular mass of 23.97 kDa. The Prolactin Receptor is purified by proprietary chromatographic techniques according to Bignon et al. (1994) JBC 269; 3318-24 and tested according to Gertler et al. (1996) JBC 271; 24482-91.
Storage & Handling
Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles as they cause oligomerization of the protein.
Cite This Product
PRL-R Prolactin Soluble Receptor Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP16471)
Form
Sterile filtered white lyophilized powder.
Formulation
The Prolactin Receptor was lyophilized from a concentrated (0.4mg/ml) solution with 0.0045mM NaHCO3.
Purity
Greater than 97.0% as determined by (a) Analysis by SEC-HPLC, (b) Analysis by SDS-PAGE, and (c) Gel filtration at pH 8 under non denaturative conditions.
Predicted MW
69.506kDa
Reconstitution
It is recommended to reconstitute the lyophilized PRLR in sterile 18M-cm H2O not less than 100µg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCH FGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYL WIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVR CKPDHGYWSAWSPATFIQIPSDFTMNDTTVW
Biological Activity
Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio.
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized PRLR in sterile 18M-cm H2O not less than 100µg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For PRLR (Source: Uniprot.org, NCBI)
Gene Name
PRLR
Full Name
Prolactin receptor
Weight
69.506kDa
Superfamily
type I cytokine receptor family
Alternative Names
PRL-R; hPRLrI PRLR HPRL, MFAB, RI-PRLR, hPRLrI prolactin receptor prolactin receptor|hPRL receptor|secreted prolactin binding protein
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on PRLR, check out the PRLR Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PRLR: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For PRL-R Prolactin Soluble Receptor Human Recombinant Protein (PROTP16471)
Hello CJ!
No publications found for PROTP16471
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used PRL-R Prolactin Soluble Receptor Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For PRL-R Prolactin Soluble Receptor Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question