PREI3 (MOB4) (NM_199482) Human Recombinant Protein

MOBKL3 protein,

Product Info Summary

SKU: PROTQ9Y3A3
Size: 20 µg
Source: HEK293T

Product Name

PREI3 (MOB4) (NM_199482) Human Recombinant Protein

View all MOBKL3 recombinant proteins

SKU/Catalog Number

PROTQ9Y3A3

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PREI3 (MOB4) (NM_199482) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y3A3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.1 kDa

Amino Acid Sequence

MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA

Validation Images & Assay Conditions

Gene/Protein Information For MOB4 (Source: Uniprot.org, NCBI)

Gene Name

MOB4

Full Name

MOB-like protein phocein

Weight

22.1 kDa

Superfamily

MOB1/phocein family

Alternative Names

2C4D; CGI-95; Class II mMOB1; MOB1; MOB1, Mps One Binder kinase activator-like 3 (yeast); MOB1DKFZP564M112; Mob3; MOB3MGC12264; MOB4 MOB family member 4, phocein; MOBKL3; phocein; PHOCN; PREI3; PREI3mps one binder kinase activator-like 3; Preimplantation protein 3Mob1 homolog 3,2C4DCGI-95

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MOB4, check out the MOB4 Infographic

MOB4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MOB4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y3A3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PREI3 (MOB4) (NM_199482) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PREI3 (MOB4) (NM_199482) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PREI3 (MOB4) (NM_199482) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y3A3
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.