PRAF1 (POLR1E) (NM_022490) Human Recombinant Protein

PRAF1 protein,

Recombinant protein of human polymerase (RNA) I polypeptide E, 53kDa (POLR1E)

Product Info Summary

SKU: PROTQ9GZS1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PRAF1 (POLR1E) (NM_022490) Human Recombinant Protein

View all PRAF1 recombinant proteins

SKU/Catalog Number

PROTQ9GZS1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human polymerase (RNA) I polypeptide E, 53kDa (POLR1E)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PRAF1 (POLR1E) (NM_022490) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9GZS1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

47.1 kDa

Amino Acid Sequence

MAAEVLPSARWQYCGAPDGSQRAVLVQFSNGKLQSPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTLCRHFVGILNKTSGQMEVYDAELFNMQPLFSDVSVESELALESQTKTYREKMDSCIEAFGTTKQKRALNTRRMNRVGNESLNRAVAKAAETIIDTKGVTALVSDAIHNDLQDDSLYLPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGPGVPHIINTKLLKHFTCLTYNNGRLRNLISDSMKAKITAYVIILALHIHDFQIDLTVLQRDLKLSEKRMMEIAKAMRLKISKRKVSVAAGSEEDHKLGTLSLPLPPAQTSDRLAKRRKIT

Validation Images & Assay Conditions

Gene/Protein Information For POLR1E (Source: Uniprot.org, NCBI)

Gene Name

POLR1E

Full Name

DNA-directed RNA polymerase I subunit RPA49

Weight

47.1 kDa

Superfamily

eukaryotic RPA49/POLR1E RNA polymerase subunit family

Alternative Names

DNA-directed RNA polymerase I subunit E; DNA-directed RNA polymerase I subunit RPA49; FLJ13390; FLJ13970; FLJ43482; PAF53RNA polymerase I-associated factor 1; polymerase (RNA) I associated factor 1; polymerase (RNA) I polypeptide E, 53kDa; PRAF1; RNA polymerase I associated factor 53; RNA polymerase I subunit A49; RNA polymerase I-associated factor 53; RP11-405L18.3 Polr1e|53kD, 53kDa, AU042259, D030019D19Rik, Paf, Paf53, Pr, Praf1|polymerase (RNA) I polypeptide E|DNA-directed RNA polymerase I subunit RPA49|DNA-directed RNA polymerase I subunit E|RNA polymerase I associated factor (Paf53)|RNA polymerase I subunit A49|RNA polymerase I-associated factor 53|polymerase (RNA) I associated factor 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on POLR1E, check out the POLR1E Infographic

POLR1E infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POLR1E: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9GZS1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PRAF1 (POLR1E) (NM_022490) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PRAF1 (POLR1E) (NM_022490) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PRAF1 (POLR1E) (NM_022490) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9GZS1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.