PPPDE2 (DESI1) (NM_015704) Human Recombinant Protein

PPPDE2 protein,

Product Info Summary

SKU: PROTQ6ICB0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PPPDE2 (DESI1) (NM_015704) Human Recombinant Protein

View all PPPDE2 recombinant proteins

SKU/Catalog Number

PROTQ6ICB0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human PPPDE peptidase domain containing 2 (PPPDE2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PPPDE2 (DESI1) (NM_015704) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6ICB0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.1 kDa

Amino Acid Sequence

MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQS

Validation Images & Assay Conditions

Gene/Protein Information For DESI1 (Source: Uniprot.org, NCBI)

Gene Name

DESI1

Full Name

Desumoylating isopeptidase 1

Weight

18.1 kDa

Superfamily

DeSI family

Alternative Names

D15Wsu75e; DJ347H13.4; FAM152B; family with sequence similarity 152, member B; MGC138384; PPPDE peptidase domain containing 2; PPPDE peptidase domain-containing protein 2; Protein FAM152B DESI1 D15Wsu75e, DESI2, DJ347H13.4, DeSI-1, FAM152B, POST, PPPDE2 desumoylating isopeptidase 1 desumoylating isopeptidase 1|PPPDE peptidase domain containing 2|PPPDE peptidase domain-containing protein 2|desumoylating isopeptidase 2|family with sequence similarity 152, member B|polyubiquitinated substrate transporter

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DESI1, check out the DESI1 Infographic

DESI1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DESI1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6ICB0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PPPDE2 (DESI1) (NM_015704) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PPPDE2 (DESI1) (NM_015704) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PPPDE2 (DESI1) (NM_015704) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6ICB0
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.