PPP2R4 (PTPA) (NM_021131) Human Recombinant Protein

PTPA protein,

Recombinant protein of human protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 3

Product Info Summary

SKU: PROTQ15257
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PPP2R4 (PTPA) (NM_021131) Human Recombinant Protein

View all PTPA recombinant proteins

SKU/Catalog Number

PROTQ15257

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PPP2R4 (PTPA) (NM_021131) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15257)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.6 kDa

Amino Acid Sequence

MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG

Validation Images & Assay Conditions

Gene/Protein Information For PTPA (Source: Uniprot.org, NCBI)

Gene Name

PTPA

Full Name

Serine/threonine-protein phosphatase 2A activator

Weight

36.6 kDa

Superfamily

PTPA-type PPIase family

Alternative Names

Serine/threonine-protein phosphatase 2A activator PTPA PP2A, PPP2R4, PR53 protein phosphatase 2 phosphatase activator serine/threonine-protein phosphatase 2A activator|PP2A phosphatase activator|phosphotyrosyl phosphatase activator|protein phosphatase 2 regulatory subunit 4|protein phosphatase 2A activator, regulatory subunit 4|protein phosphatase 2A regulatory subunit 4|protein phosphatase 2A, regulatory subunit B (PR 53)|serine/threonine-protein phosphatase 2A regulatory subunit B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PTPA, check out the PTPA Infographic

PTPA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PTPA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15257

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PPP2R4 (PTPA) (NM_021131) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PPP2R4 (PTPA) (NM_021131) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PPP2R4 (PTPA) (NM_021131) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15257
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.