PPP1R11 (NM_021959) Human Recombinant Protein

PPP1R11 protein,

Product Info Summary

SKU: PROTO60927
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PPP1R11 (NM_021959) Human Recombinant Protein

View all PPP1R11 recombinant proteins

SKU/Catalog Number

PROTO60927

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 11 (PPP1R11)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PPP1R11 (NM_021959) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO60927)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.8 kDa

Amino Acid Sequence

MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH

Validation Images & Assay Conditions

Gene/Protein Information For PPP1R11 (Source: Uniprot.org, NCBI)

Gene Name

PPP1R11

Full Name

E3 ubiquitin-protein ligase PPP1R11

Weight

13.8 kDa

Alternative Names

HCG V; HCG-V; inhibitor-3; IPP3; protein phosphatase 1 regulatory subunit 11; protein phosphatase 1, regulatory (inhibitor) subunit 11; TCTE5; TCTEX5 PPP1R11 CFAP255, HCG-V, HCGV, IPP3, TCTE5, TCTEX5 protein phosphatase 1 regulatory inhibitor subunit 11 E3 ubiquitin-protein ligase PPP1R11|HCG V|hemochromatosis candidate gene V protein|inhibitor-3|protein phosphatase 1 regulatory subunit 11|protein phosphatase inhibitor 3|t-complex-associated-testis-expressed 5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PPP1R11, check out the PPP1R11 Infographic

PPP1R11 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PPP1R11: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO60927

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PPP1R11 (NM_021959) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PPP1R11 (NM_021959) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PPP1R11 (NM_021959) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO60927
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.