PNPO (NM_018129) Human Recombinant Protein

PNPO protein,

Product Info Summary

SKU: PROTQ9NVS9
Size: 20 µg
Source: HEK293T

Product Name

PNPO (NM_018129) Human Recombinant Protein

View all PNPO recombinant proteins

SKU/Catalog Number

PROTQ9NVS9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human pyridoxamine 5'-phosphate oxidase (PNPO)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PNPO (NM_018129) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NVS9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.8 kDa

Amino Acid Sequence

MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP

Validation Images & Assay Conditions

Gene/Protein Information For PNPO (Source: Uniprot.org, NCBI)

Gene Name

PNPO

Full Name

Pyridoxine-5'-phosphate oxidase

Weight

29.8 kDa

Superfamily

pyridoxamine 5'-phosphate oxidase family

Alternative Names

EC 1.4.3.5; FLJ10535; PDXPO; pyridoxal 5'-phosphate synthase; pyridoxamine 5'-phosphate oxidase; Pyridoxamine-phosphate oxidase; pyridoxine 5'-phosphate oxidase; pyridoxine-5'-phosphate oxidase PNPO HEL-S-302, PDXPO pyridoxamine 5-phosphate oxidase pyridoxine-5-phosphate oxidase|epididymis secretory protein Li 302|epididymis secretory sperm binding protein|pyridoxal 5-phosphate synthase|pyridoxamine-phosphate oxidase|pyridoxine 5-phosphate oxidase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PNPO, check out the PNPO Infographic

PNPO infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PNPO: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NVS9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PNPO (NM_018129) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PNPO (NM_018129) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PNPO (NM_018129) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NVS9
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.