PLA2G1B (NM_000928) Human Recombinant Protein

PLA2G1B protein,

Product Info Summary

SKU: PROTP04054
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PLA2G1B (NM_000928) Human Recombinant Protein

View all PLA2G1B recombinant proteins

SKU/Catalog Number

PROTP04054

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phospholipase A2, group IB (pancreas) (PLA2G1B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PLA2G1B (NM_000928) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP04054)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.2 kDa

Amino Acid Sequence

MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS

Validation Images & Assay Conditions

Gene/Protein Information For PLA2G1B (Source: Uniprot.org, NCBI)

Gene Name

PLA2G1B

Full Name

Phospholipase A2

Weight

16.2 kDa

Superfamily

phospholipase A2 family

Alternative Names

Group IB phospholipase A2; Phosphatidylcholine 2-acylhydrolase 1B; phospholipase A2; phospholipase A2, group IB (pancreas); PLA2; PLA2A; PLA2AMGC119834; PLA2EC 3.1.1.4; PLA2G1B; PPLA2; PPLA2MGC119835 PLA2G1B PLA2, PLA2A, PPLA2 phospholipase A2 group IB phospholipase A2|phosphatidylcholine 2-acylhydrolase 1B|phospholipase A2, group IB (pancreas)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PLA2G1B, check out the PLA2G1B Infographic

PLA2G1B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PLA2G1B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP04054

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PLA2G1B (NM_000928) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PLA2G1B (NM_000928) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PLA2G1B (NM_000928) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP04054
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.