PIST (GOPC) (NM_020399) Human Recombinant Protein

PIST protein,

Product Info Summary

SKU: PROTQ9HD26
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PIST (GOPC) (NM_020399) Human Recombinant Protein

View all PIST recombinant proteins

SKU/Catalog Number

PROTQ9HD26

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human golgi associated PDZ and coiled-coil motif containing (GOPC), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PIST (GOPC) (NM_020399) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9HD26)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

50.3 kDa

Amino Acid Sequence

MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY

Validation Images & Assay Conditions

Gene/Protein Information For GOPC (Source: Uniprot.org, NCBI)

Gene Name

GOPC

Full Name

Golgi-associated PDZ and coiled-coil motif-containing protein

Weight

50.3 kDa

Alternative Names

CALPDZ protein interacting specifically with TC10; CFTR-associated ligand; dJ94G16.2; FIGdJ94G16.2 PIST; Fused in glioblastoma; golgi-associated PDZ and coiled-coil motif containing; Golgi-associated PDZ and coiled-coil motif-containing protein; GOPC1; PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10; PISTGolgi associated PDZ and coiled-coil motif containing protein GOPC CAL, FIG1, PIST, dJ94G16.2, GOPC golgi associated PDZ and coiled-coil motif containing Golgi-associated PDZ and coiled-coil motif-containing protein|CFTR-associated ligand|PDZ protein interacting specifically with TC10|PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10|dJ94G16.2 PIST|fused in glioblastoma|golgi-associated PDZ and coiled-coil motif containing protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GOPC, check out the GOPC Infographic

GOPC infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GOPC: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9HD26

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PIST (GOPC) (NM_020399) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PIST (GOPC) (NM_020399) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PIST (GOPC) (NM_020399) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9HD26
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product