PIGL (NM_004278) Human Recombinant Protein

PIGL protein,

Recombinant protein of human phosphatidylinositol glycan anchor biosynthesis, class L (PIGL)

Product Info Summary

SKU: PROTQ9Y2B2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PIGL (NM_004278) Human Recombinant Protein

View all PIGL recombinant proteins

SKU/Catalog Number

PROTQ9Y2B2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phosphatidylinositol glycan anchor biosynthesis, class L (PIGL)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PIGL (NM_004278) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y2B2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28.4 kDa

Amino Acid Sequence

MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHWVYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGINLVVTFDAGGVSGHSNHIALYAAVRALHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPLSLLHTQDVLFVLNSKEVAQAKKAMSCHRSQLLWFRRLYIIFSRYMRINSLSFL

Validation Images & Assay Conditions

Gene/Protein Information For PIGL (Source: Uniprot.org, NCBI)

Gene Name

PIGL

Full Name

N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase

Weight

28.4 kDa

Superfamily

PIGL family

Alternative Names

EC 3.5.1.89; N-acetylglucosaminylphosphatidylinositol deacetylase; N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase; phosphatidylinositol glycan anchor biosynthesis, class L; phosphatidylinositol glycan, class L; Phosphatidylinositol-glycan biosynthesis class L protein; PIG-L PIGL CHIME phosphatidylinositol glycan anchor biosynthesis class L N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase|N-acetylglucosaminylphosphatidylinositol deacetylase|PIG-L|phosphatidylinositol glycan, class L|phosphatidylinositol-glycan biosynthesis class L protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PIGL, check out the PIGL Infographic

PIGL infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PIGL: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y2B2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PIGL (NM_004278) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PIGL (NM_004278) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PIGL (NM_004278) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y2B2
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.