PHYHIP (NM_014759) Human Recombinant Protein

PHYHIP protein,

Recombinant protein of human phytanoyl-CoA 2-hydroxylase interacting protein (PHYHIP), transcript variant 2

Product Info Summary

SKU: PROTQ92561
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PHYHIP (NM_014759) Human Recombinant Protein

View all PHYHIP recombinant proteins

SKU/Catalog Number

PROTQ92561

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phytanoyl-CoA 2-hydroxylase interacting protein (PHYHIP), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PHYHIP (NM_014759) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ92561)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

37.4 kDa

Amino Acid Sequence

MELLSTPHSIEINNITCDSFSISWAMEDSDLERVTHYFIDLNKKENKNSNKFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYLVSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFEHARTHCGNMLQPYLKDNSGSHGSPTSGMLHGVFFSCNTEFNTGQPPQDSPYGRWRFQIPAQRLFNPSTNLYFADFYCMYTAYHYAILVLAPKGSMGDRFCRDRRPLLDIACNKFLTCSVEDGELVFRHAQDLILEIIYTEPVDLSLGTLGEISGHQLMSLSTADAKKDPSCKTCNISVGR

Validation Images & Assay Conditions

Gene/Protein Information For PHYHIP (Source: Uniprot.org, NCBI)

Gene Name

PHYHIP

Full Name

Phytanoyl-CoA hydroxylase-interacting protein

Weight

37.4 kDa

Superfamily

PHYHIP family

Alternative Names

DYRK1A interacting protein 3; DYRK1AP3; KIAA0273PAHX-AP1; PAHX-AP; PAHXAP1; phytanoyl-CoA 2-hydroxylase interacting protein; phytanoyl-CoA alpha-hydroxylase associated protein; phytanoyl-CoA hydroxylase interacting protein; Phytanoyl-CoA hydroxylase-associated protein 1; phytanoyl-CoA hydroxylase-interacting protein PHYHIP DYRK1AP3, PAHX-AP, PAHXAP1 phytanoyl-CoA 2-hydroxylase interacting protein phytanoyl-CoA hydroxylase-interacting protein|DYRK1A interacting protein 3|PAHX-AP1|phytanoyl-CoA alpha-hydroxylase associated protein|phytanoyl-CoA hydroxylase-associated protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PHYHIP, check out the PHYHIP Infographic

PHYHIP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PHYHIP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ92561

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PHYHIP (NM_014759) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PHYHIP (NM_014759) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PHYHIP (NM_014759) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ92561
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product