PDP2 (NM_020786) Human Recombinant Protein

PDP2 protein,

Recombinant protein of human pyruvate dehydrogenase phosphatase isoenzyme 2 (PDP2)

Product Info Summary

SKU: PROTQ9P2J9
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PDP2 (NM_020786) Human Recombinant Protein

View all PDP2 recombinant proteins

SKU/Catalog Number

PROTQ9P2J9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human pyruvate dehydrogenase phosphatase isoenzyme 2 (PDP2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PDP2 (NM_020786) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9P2J9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

59.8 kDa

Amino Acid Sequence

MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLCKAYRHTSTEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLHVANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGDVQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAERLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG

Validation Images & Assay Conditions

Gene/Protein Information For PDP2 (Source: Uniprot.org, NCBI)

Gene Name

PDP2

Full Name

[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial

Weight

59.8 kDa

Superfamily

PP2C family

Alternative Names

EC 3.1.3; EC 3.1.3.43; KIAA1348[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial; PDP 2; PDPC 2; PPM2C2; protein phosphatase 2C, magnesium-dependent, catalytic subunit 2; Pyruvate dehydrogenase phosphatase catalytic subunit 2; pyruvate dehydrogenase phosphatase isoenzyme 2; pyruvate dehydrogenase phosphatase, catalytic subunit 2; pyruvate dehyrogenase phosphatase catalytic subunit 2 PDP2 PDPC 2, PPM2B, PPM2C2 pyruvate dehyrogenase phosphatase catalytic subunit 2 [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial|protein phosphatase 2C, magnesium-dependent, catalytic subunit 2|protein phosphatase, Mg2+/Mn2+ dependent 2B|pyruvate dehydrogenase phosphatase isoenzyme 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PDP2, check out the PDP2 Infographic

PDP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PDP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9P2J9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PDP2 (NM_020786) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PDP2 (NM_020786) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PDP2 (NM_020786) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9P2J9
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.