PDE6H (NM_006205) Human Recombinant Protein

PDE6H protein,

Product Info Summary

SKU: PROTQ13956
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PDE6H (NM_006205) Human Recombinant Protein

View all PDE6H recombinant proteins

SKU/Catalog Number

PROTQ13956

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phosphodiesterase 6H, cGMP-specific, cone, gamma (PDE6H)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PDE6H (NM_006205) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13956)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

8.9 kDa

Amino Acid Sequence

MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFGII

Validation Images & Assay Conditions

Gene/Protein Information For PDE6H (Source: Uniprot.org, NCBI)

Gene Name

PDE6H

Full Name

Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma

Weight

8.9 kDa

Superfamily

rod/cone cGMP-PDE gamma subunit family

Alternative Names

Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma PDE6H ACHM6, RCD3 phosphodiesterase 6H retinal cone rhodopsin-sensitive cGMP 3,5-cyclic phosphodiesterase subunit gamma|GMP-PDE gamma|phosphodiesterase 6H, cGMP-specific, cone, gamma

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PDE6H, check out the PDE6H Infographic

PDE6H infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PDE6H: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13956

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PDE6H (NM_006205) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PDE6H (NM_006205) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PDE6H (NM_006205) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13956
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.