PCTAIRE2 (CDK17) (NM_002595) Human Recombinant Protein

PCTAIRE2 protein,

Recombinant protein of human PCTAIRE protein kinase 2 (PCTK2)

Product Info Summary

SKU: PROTQ00537
Size: 20 µg
Source: HEK293T

Product Name

PCTAIRE2 (CDK17) (NM_002595) Human Recombinant Protein

View all PCTAIRE2 recombinant proteins

SKU/Catalog Number

PROTQ00537

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human PCTAIRE protein kinase 2 (PCTK2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PCTAIRE2 (CDK17) (NM_002595) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ00537)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

59.4 kDa

Amino Acid Sequence

MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMEDLNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNEEFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF

Validation Images & Assay Conditions

Gene/Protein Information For CDK17 (Source: Uniprot.org, NCBI)

Gene Name

CDK17

Full Name

Cyclin-dependent kinase 17

Weight

59.4 kDa

Superfamily

protein kinase superfamily

Alternative Names

Cell division protein kinase 17; cyclin-dependent kinase 17; EC 2.7.11; EC 2.7.11.22; PCTAIRE protein kinase 2; PCTAIRE2; PCTAIRE-motif protein kinase 2; PCTK2; protein kinase cdc2-related PCTAIRE-2; Serine/threonine-protein kinase PCTAIRE-2 CDK17 PCTAIRE2, PCTK2 cyclin dependent kinase 17 cyclin-dependent kinase 17|PCTAIRE-motif protein kinase 2|cell division protein kinase 17|protein kinase cdc2-related PCTAIRE-2|serine/threonine-protein kinase PCTAIRE-2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CDK17, check out the CDK17 Infographic

CDK17 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CDK17: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ00537

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PCTAIRE2 (CDK17) (NM_002595) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PCTAIRE2 (CDK17) (NM_002595) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PCTAIRE2 (CDK17) (NM_002595) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ00537
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.