PCBD1 (NM_000281) Human Recombinant Protein

PCBD1 protein,

Product Info Summary

SKU: PROTP61457
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PCBD1 (NM_000281) Human Recombinant Protein

View all PCBD1 recombinant proteins

SKU/Catalog Number

PROTP61457

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (PCBD1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PCBD1 (NM_000281) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP61457)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.8 kDa

Amino Acid Sequence

MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

Validation Images & Assay Conditions

Gene/Protein Information For PCBD1 (Source: Uniprot.org, NCBI)

Gene Name

PCBD1

Full Name

Pterin-4-alpha-carbinolamine dehydratase

Weight

11.8 kDa

Superfamily

pterin-4-alpha-carbinolamine dehydratase family

Alternative Names

4-alpha-hydroxy-tetrahydropterin dehydratase; DCoH; DCOHpterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1); Dimerization cofactor of hepatocyte nuclear factor 1-alpha; Dimerization cofactor of HNF1; PCBDdimerizing cofactor for HNF1,6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1); PCDEC 4.2.1.96; Phenylalanine hydroxylase-stimulating protein; PHS; Pterin carbinolamine dehydratase; pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha; pterin-4 PCBD1 DCOH, PCBD, PCD, PHS pterin-4 alpha-carbinolamine dehydratase 1 pterin-4-alpha-carbinolamine dehydratase|4-alpha-hydroxy-tetrahydropterin dehydratase|6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1)|dimerizing cofactor for HNF1|phenylalanine hydroxylase-stimulating protein|pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PCBD1, check out the PCBD1 Infographic

PCBD1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PCBD1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP61457

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PCBD1 (NM_000281) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PCBD1 (NM_000281) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PCBD1 (NM_000281) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP61457
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product