PAFAH2 (NM_000437) Human Recombinant Protein

PAFAH2 protein,

Product Info Summary

SKU: PROTQ99487
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PAFAH2 (NM_000437) Human Recombinant Protein

View all PAFAH2 recombinant proteins

SKU/Catalog Number

PROTQ99487

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human platelet-activating factor acetylhydrolase 2, 40kDa (PAFAH2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PAFAH2 (NM_000437) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99487)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

43.9 kDa

Amino Acid Sequence

MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNKRCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL

Validation Images & Assay Conditions

Gene/Protein Information For PAFAH2 (Source: Uniprot.org, NCBI)

Gene Name

PAFAH2

Full Name

Platelet-activating factor acetylhydrolase 2, cytoplasmic

Weight

43.9 kDa

Superfamily

serine esterase family

Alternative Names

EC 3.1.1; EC 3.1.1.47; FLJ26025; HSD-PLA2; platelet-activating factor acetylhydrolase 2 (40kD); platelet-activating factor acetylhydrolase 2, 40kDa; platelet-activating factor acetylhydrolase 2, cytoplasmic; SD-PLA2; Serine-dependent phospholipase A2 PAFAH2 HSD-PLA2 platelet activating factor acetylhydrolase 2 platelet-activating factor acetylhydrolase 2, cytoplasmic|PAF:lysophospholipid transacetylase|PAF:sphingosine transacetylase|SD-PLA2|platelet-activating factor acetylhydrolase 2, 40kDa|platelet-activating factor acetyltransferase PAFAH2|serine-dependent phospholipase A2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PAFAH2, check out the PAFAH2 Infographic

PAFAH2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PAFAH2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99487

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PAFAH2 (NM_000437) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PAFAH2 (NM_000437) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PAFAH2 (NM_000437) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99487
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product