p21 Ras (HRAS) (NM_001130442) Human Recombinant Protein

HRAS protein,

Product Info Summary

SKU: PROTP01112
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

p21 Ras (HRAS) (NM_001130442) Human Recombinant Protein

View all HRAS recombinant proteins

SKU/Catalog Number

PROTP01112

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

p21 Ras (HRAS) (NM_001130442) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01112)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.1 kDa

Amino Acid Sequence

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLVRSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For HRAS (Source: Uniprot.org, NCBI)

Gene Name

HRAS

Full Name

GTPase HRas

Weight

21.1 kDa

Superfamily

small GTPase superfamily

Alternative Names

Nothing Found HRAS C-BAS/HAS, C-H-RAS, C-HA-RAS1, CTLO, H-RASIDX, HAMSV1, RASH1, p21ras, HRAS HRas proto-oncogene, GTPase GTPase HRas|GTP- and GDP-binding peptide B|Ha-Ras1 proto-oncoprotein|Harvey rat sarcoma viral oncogene homolog|Harvey rat sarcoma viral oncoprotein|Ras family small GTP binding protein H-Ras|c-has/bas p21 protein|p19 H-RasIDX protein|transformation gene: oncogene HAMSV|transforming protein p21|v-Ha-ras Harvey rat sarcoma viral oncogene homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HRAS, check out the HRAS Infographic

HRAS infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HRAS: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP01112

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used p21 Ras (HRAS) (NM_001130442) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For p21 Ras (HRAS) (NM_001130442) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for p21 Ras (HRAS) (NM_001130442) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP01112
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.