ODF3 (NM_053280) Human Recombinant Protein

Odf3 protein,

Recombinant protein of human outer dense fiber of sperm tails 3 (ODF3)

Product Info Summary

SKU: PROTQ96PU9
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ODF3 (NM_053280) Human Recombinant Protein

View all Odf3 recombinant proteins

SKU/Catalog Number

PROTQ96PU9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human outer dense fiber of sperm tails 3 (ODF3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ODF3 (NM_053280) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96PU9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.5 kDa

Amino Acid Sequence

MTEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRYNVNPKILRTGKDLGPAYSILGRYQTKTMLTPGPGDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPGPAAYMLPMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLTKPCAPVVTFGIKHSDYMTPLLVDVE

Validation Images & Assay Conditions

Gene/Protein Information For ODF3 (Source: Uniprot.org, NCBI)

Gene Name

ODF3

Full Name

Outer dense fiber protein 3

Weight

27.5 kDa

Superfamily

ODF3 family

Alternative Names

CT135; hSHIPPO; outer dense fiber of sperm tails 3; outer dense fiber of sperm tails protein 3; outer dense fiber protein 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ODF3, check out the ODF3 Infographic

ODF3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ODF3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used ODF3 (NM_053280) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ODF3 (NM_053280) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ODF3 (NM_053280) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96PU9
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.