NUDT4 (NM_019094) Human Recombinant Protein

NUDT4 protein,

Product Info Summary

SKU: PROTQ9NZJ9
Size: 20 µg
Source: HEK293T

Product Name

NUDT4 (NM_019094) Human Recombinant Protein

View all NUDT4 recombinant proteins

SKU/Catalog Number

PROTQ9NZJ9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 4 (NUDT4), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NUDT4 (NM_019094) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NZJ9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.1 kDa

Amino Acid Sequence

MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR

Validation Images & Assay Conditions

Gene/Protein Information For NUDT4 (Source: Uniprot.org, NCBI)

Gene Name

NUDT4

Full Name

Diphosphoinositol polyphosphate phosphohydrolase 2

Weight

20.1 kDa

Superfamily

Nudix hydrolase family

Alternative Names

Diphosphoinositol polyphosphate phosphohydrolase 2 NUDT4 DIPP-2B, DIPP2, DIPP2alpha, DIPP2beta, HDCMB47PB, NUDT4 nudix hydrolase 4 diphosphoinositol polyphosphate phosphohydrolase 2|DIPP-2|Diphosphoinositol polyphosphate phosphohydrolase NUDT4B|Nucleoside diphosphate-linked moiety X motif 4B|Nudix hydrolase 4B|Nudix motif 4B|diadenosine 5,5-P1,P6-hexaphosphate hydrolase 2|diphosphoinositol polyphosphate phosphohydrolase type 2|nudix (nucleoside diphosphate linked moiety X)-type motif 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NUDT4, check out the NUDT4 Infographic

NUDT4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NUDT4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used NUDT4 (NM_019094) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NUDT4 (NM_019094) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NUDT4 (NM_019094) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NZJ9
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.