NUDT2 (NM_147172) Human Recombinant Protein

NUDT2 protein,

Product Info Summary

SKU: PROTP50583
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NUDT2 (NM_147172) Human Recombinant Protein

View all NUDT2 recombinant proteins

SKU/Catalog Number

PROTP50583

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NUDT2 (NM_147172) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP50583)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.6 kDa

Amino Acid Sequence

MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA

Validation Images & Assay Conditions

Gene/Protein Information For NUDT2 (Source: Uniprot.org, NCBI)

Gene Name

NUDT2

Full Name

Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]

Weight

16.6 kDa

Superfamily

Nudix hydrolase family

Alternative Names

Ap4A hydrolase 1; Ap4A hydrolase; Ap4Aase; APAH1Diadenosine 5'-5'''-P1; bis(5'-nucleosyl)-tetraphosphatase (asymmetrical); bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]; diadenosine 5'-5''-P1; Diadenosine tetraphosphatase; EC 3.6.1.17; MGC10404; Nucleoside diphosphate-linked moiety X motif 2; nudix (nucleoside diphosphate linked moiety X)-type motif 2; Nudix motif 2; P4-tetraphosphate asymmetrical hydrolase; P4-tetraphosphate pyrophosphohydrolase NUDT2 APAH1 nudix hydrolase 2 bis(5-nucleosyl)-tetraphosphatase [asymmetrical]|Ap4A hydrolase 1|Ap4Aase|bis(5-nucleosyl)-tetraphosphatase (asymmetrical)|diadenosine 5,5-P1,P4-tetraphosphate asymmetrical hydrolase|diadenosine 5,5-P1,P4-tetraphosphate pyrophosphohydrolase|diadenosine tetraphosphatase|nucleoside diphosphate-linked moiety X motif 2|nudix (nucleoside diphosphate linked moiety X)-type motif 2|nudix motif 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NUDT2, check out the NUDT2 Infographic

NUDT2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NUDT2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP50583

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NUDT2 (NM_147172) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NUDT2 (NM_147172) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NUDT2 (NM_147172) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP50583
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.