NUDT18 (NM_024815) Human Recombinant Protein

NUDT18 protein,

Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 18 (NUDT18)

Product Info Summary

SKU: PROTQ6ZVK8
Size: 20 µg
Source: HEK293T

Product Name

NUDT18 (NM_024815) Human Recombinant Protein

View all NUDT18 recombinant proteins

SKU/Catalog Number

PROTQ6ZVK8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 18 (NUDT18)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NUDT18 (NM_024815) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6ZVK8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.3 kDa

Amino Acid Sequence

MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVFLSEQDEVLLIQEAKRECRGSWYLPAGRMEPGETIVEALQREVKEEAGLHCEPETLLSVEERGPSWVRFVFLARPTGGILKTSKEADAESLQAAWYPRTSLPTPLRAHDILHLVELAAQYRQQARHPLILPQELPCDLVCQRLVATFTSAQTVWVLVGTVGMPHLPVTACGLDPMEQRGGMKMAVLRLLQECLTLHHLVVEIKGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKVMEEDLQSQLLQRLQGSSVVPVNR

Validation Images & Assay Conditions

Gene/Protein Information For NUDT18 (Source: Uniprot.org, NCBI)

Gene Name

NUDT18

Full Name

8-oxo-dGDP phosphatase NUDT18

Weight

35.3 kDa

Superfamily

Nudix hydrolase family

Alternative Names

EC 3.6.1; EC 3.6.1.-; FLJ22494; nucleoside diphosphate-linked moiety X motif 18; nudix (nucleoside diphosphate linked moiety X)-type motif 18; Nudix motif 18 NUDT18 MTH3 nudix hydrolase 18 8-oxo-dGDP phosphatase NUDT18|2-hydroxy-dADP phosphatase|7,8-dihydro-8-oxoguanine phosphatase|mutT homolog 3|mutT human homolog 3|nucleoside diphosphate-linked moiety X motif 18|nudix (nucleoside diphosphate linked moiety X)-type motif 18|nudix motif 18

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NUDT18, check out the NUDT18 Infographic

NUDT18 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NUDT18: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6ZVK8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NUDT18 (NM_024815) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NUDT18 (NM_024815) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NUDT18 (NM_024815) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6ZVK8
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.