Nucleoside phosphorylase (PNP) (NM_000270) Human Recombinant Protein

Purine Nucleoside Phosphorylase/PNP protein,

Product Info Summary

SKU: PROTP00491
Size: 20 µg
Source: HEK293T

Product Name

Nucleoside phosphorylase (PNP) (NM_000270) Human Recombinant Protein

View all Purine Nucleoside Phosphorylase/PNP recombinant proteins

SKU/Catalog Number

PROTP00491

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nucleoside phosphorylase (NP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Nucleoside phosphorylase (PNP) (NM_000270) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP00491)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

31.9 kDa

Amino Acid Sequence

MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS

Validation Images & Assay Conditions

Gene/Protein Information For PNP (Source: Uniprot.org, NCBI)

Gene Name

PNP

Full Name

Purine nucleoside phosphorylase

Weight

31.9 kDa

Superfamily

PNP/MTAP phosphorylase family

Alternative Names

EC 2.4.2.1; FLJ94043; FLJ97288; Inosine phosphorylase; MGC117396; MGC125915; MGC125916; NPFLJ97312; nucleoside phosphorylase; PNP; PRO1837; PUNP; purine nucleoside phosphorylase; purine-nucleoside:orthophosphate ribosyltransferase PNP NP, PRO1837, PUNP purine nucleoside phosphorylase purine nucleoside phosphorylase|HEL-S-156an|epididymis secretory sperm binding protein Li 156an|inosine phosphorylase|inosine-guanosine phosphorylase|purine-nucleoside:orthophosphate ribosyltransferase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PNP, check out the PNP Infographic

PNP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PNP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP00491

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Nucleoside phosphorylase (PNP) (NM_000270) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Nucleoside phosphorylase (PNP) (NM_000270) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Nucleoside phosphorylase (PNP) (NM_000270) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP00491
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.