NUCKS1 (NM_022731) Human Recombinant Protein

Nucks1 protein,

Recombinant protein of human nuclear casein kinase and cyclin-dependent kinase substrate 1 (NUCKS1)

Product Info Summary

SKU: PROTQ9H1E3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NUCKS1 (NM_022731) Human Recombinant Protein

View all Nucks1 recombinant proteins

SKU/Catalog Number

PROTQ9H1E3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nuclear casein kinase and cyclin-dependent kinase substrate 1 (NUCKS1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NUCKS1 (NM_022731) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H1E3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.1 kDa

Amino Acid Sequence

MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED

Validation Images & Assay Conditions

Gene/Protein Information For NUCKS1 (Source: Uniprot.org, NCBI)

Gene Name

NUCKS1

Full Name

Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1

Weight

27.1 kDa

Alternative Names

FLJ21480; FLJ32016; FLJ38536; NUCKSnuclear ubiquitous casein and cyclin-dependent kinases substrate; nuclear casein kinase and cyclin-dependent kinase substrate 1; nuclear ubiquitous casein kinase and cyclin-dependent kinase substrate; P1; potential LAG1 interactor Nucks1|Nucks|nuclear casein kinase and cyclin-dependent kinase substrate 1|nuclear ubiquitous casein and cyclin-dependent kinase substrate 1|cyclin-dependent kinase substrate|nuclear ubiquitous casein and cyclin-dependent kinases substrate|nuclear ubiquitous casein and cyclin-dependent kinases substrate-like|nuclear ubiquitous casein kinase 2|nuclear ubiquitous casein kinase and cyclin-dependent kinase substrate

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NUCKS1, check out the NUCKS1 Infographic

NUCKS1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NUCKS1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H1E3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NUCKS1 (NM_022731) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NUCKS1 (NM_022731) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NUCKS1 (NM_022731) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H1E3
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.