NT5C3 (NT5C3A) (NM_016489) Human Recombinant Protein

NT5C3A protein,

Recombinant protein of human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3

Product Info Summary

SKU: PROTQ9H0P0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NT5C3 (NT5C3A) (NM_016489) Human Recombinant Protein

View all NT5C3A recombinant proteins

SKU/Catalog Number

PROTQ9H0P0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NT5C3 (NT5C3A) (NM_016489) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H0P0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.7 kDa

Amino Acid Sequence

MTNQESAVHVKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL

Validation Images & Assay Conditions

Gene/Protein Information For NT5C3A (Source: Uniprot.org, NCBI)

Gene Name

NT5C3A

Full Name

Cytosolic 5'-nucleotidase 3A

Weight

33.7 kDa

Superfamily

pyrimidine 5'-nucleotidase family

Alternative Names

Cytosolic 5'-nucleotidase 3A NT5C3A NT5C3, P5N-1, P5N-1, PN-I, POMP, PSN1, UMPH, UMPH1, cN-III, hUMP1, p36 5-nucleotidase, cytosolic IIIA cytosolic 5-nucleotidase 3A|5-nucleotidase, cytosolic III|7-methylguanosine phosphate-specific 5-nucleotidase|cytosolic 5-nucleotidase 3|lupin|pyrimidine 5-nucleotidase 1|uridine 5-monophosphate hydrolase 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NT5C3A, check out the NT5C3A Infographic

NT5C3A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NT5C3A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H0P0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NT5C3 (NT5C3A) (NM_016489) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NT5C3 (NT5C3A) (NM_016489) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NT5C3 (NT5C3A) (NM_016489) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H0P0
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.