NRBF2 (NM_030759) Human Recombinant Protein

NRBF2 protein,

Product Info Summary

SKU: PROTQ96F24
Size: 20 µg
Source: HEK293T

Product Name

NRBF2 (NM_030759) Human Recombinant Protein

View all NRBF2 recombinant proteins

SKU/Catalog Number

PROTQ96F24

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nuclear receptor binding factor 2 (NRBF2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NRBF2 (NM_030759) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96F24)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32.2 kDa

Amino Acid Sequence

MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN

Validation Images & Assay Conditions

Gene/Protein Information For NRBF2 (Source: Uniprot.org, NCBI)

Gene Name

NRBF2

Full Name

Nuclear receptor-binding factor 2

Weight

32.2 kDa

Alternative Names

Comodulator of PPAR and RXR; COPR; COPR1; COPR2; DKFZp564C1664; FLJ30395; NRBF-2; nuclear receptor binding factor 2; nuclear receptor binding factor-2; nuclear receptor-binding factor 2 NRBF2 COPR, COPR1, COPR2, NRBF-2 nuclear receptor binding factor 2 nuclear receptor-binding factor 2|comodulator of PPAR and RXR 1|comodulator of PPAR and RXR 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NRBF2, check out the NRBF2 Infographic

NRBF2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NRBF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96F24

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NRBF2 (NM_030759) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NRBF2 (NM_030759) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NRBF2 (NM_030759) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96F24
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product