Noggin Mouse Recombinant Protein

Noggin protein, Mouse

Noggin Mouse Recombinant produced in E. coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa).

Product Info Summary

SKU: PROTP97466
Size: 5ug, 20ug, 1mg
Origin Species: Mouse
Source: Escherichia coli

Product Name

Noggin Mouse Recombinant Protein

View all Noggin recombinant proteins

SKU/Catalog Number

PROTP97466

Size

5ug, 20ug, 1mg

Description

Noggin Mouse Recombinant produced in E. coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa).

Storage & Handling

Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Cite This Product

Noggin Mouse Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP97466)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized from a 0.2μm filtered solution in 30% acetonitrile, 0.1% TFA.

Purity

Greater than 95.0% as determined by SDS-PAGE.

Predicted MW

25.774kDa

Reconstitution

It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/ml. Further dilutions should be made in appropriate buffered solutions.

Amino Acid Sequence

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD PGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKG LEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRF WPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQR CGWIPIQYPIISECKCSC

Biological Activity

The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of greater than 5.0 × 105 IU/mg in the presence of 5ng/ml BMP-4.

Reconstitution

It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/ml. Further dilutions should be made in appropriate buffered solutions.

Validation Images & Assay Conditions

Gene/Protein Information For NOG (Source: Uniprot.org, NCBI)

Gene Name

NOG

Full Name

Noggin

Weight

25.774kDa

Superfamily

noggin family

Alternative Names

Noggin; SYM1; SYNS1; NOG NOG SYM1, SYNS1, SYNS1A noggin noggin|symphalangism 1 (proximal)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NOG, check out the NOG Infographic

NOG infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NOG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP97466

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Noggin Mouse Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Noggin Mouse Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Noggin Mouse Recombinant Protein

Size

Total: $250

SKU:PROTP97466

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTP97466
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.