Product Info Summary
SKU: | PROTP97466 |
---|---|
Size: | 5ug, 20ug, 1mg |
Origin Species: | Mouse |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
Noggin Mouse Recombinant Protein
View all Noggin recombinant proteins
SKU/Catalog Number
PROTP97466
Size
5ug, 20ug, 1mg
Description
Noggin Mouse Recombinant produced in E. coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa).
Storage & Handling
Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Cite This Product
Noggin Mouse Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP97466)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2μm filtered solution in 30% acetonitrile, 0.1% TFA.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Predicted MW
25.774kDa
Reconstitution
It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/ml. Further dilutions should be made in appropriate buffered solutions.
Amino Acid Sequence
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD PGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKG LEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRF WPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQR CGWIPIQYPIISECKCSC
Biological Activity
The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of greater than 5.0 × 105 IU/mg in the presence of 5ng/ml BMP-4.
Assay dilution & Images
Reconstitution
It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/ml. Further dilutions should be made in appropriate buffered solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For NOG (Source: Uniprot.org, NCBI)
Gene Name
NOG
Full Name
Noggin
Weight
25.774kDa
Superfamily
noggin family
Alternative Names
Noggin; SYM1; SYNS1; NOG NOG SYM1, SYNS1, SYNS1A noggin noggin|symphalangism 1 (proximal)
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on NOG, check out the NOG Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NOG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Noggin Mouse Recombinant Protein (PROTP97466)
Hello CJ!
No publications found for PROTP97466
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Noggin Mouse Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Noggin Mouse Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question