Product Info Summary
SKU: | PROTP97466 |
---|---|
Size: | 5ug, 20ug, 1mg |
Origin Species: | Mouse |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
Noggin Mouse Recombinant Protein
View all Noggin recombinant proteins
SKU/Catalog Number
PROTP97466
Size
5ug, 20ug, 1mg
Description
Noggin Mouse Recombinant produced in E. coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa).
Storage & Handling
Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Cite This Product
Noggin Mouse Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP97466)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2μm filtered solution in 30% acetonitrile, 0.1% TFA.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Reconstitution
It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/ml. Further dilutions should be made in appropriate buffered solutions.
Amino Acid Sequence
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD PGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKG LEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRF WPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQR CGWIPIQYPIISECKCSC
Biological Activity
The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of greater than 5.0 × 105 IU/mg in the presence of 5ng/ml BMP-4.
Assay dilution & Images
Reconstitution
It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/ml. Further dilutions should be made in appropriate buffered solutions.
Validation Images & Assay Conditions
![recombinant protein thumbnail_1 recombinant protein thumbnail_1](https://www.bosterbio.com/media/catalog/product/r/e/recombinant-protein-thumbnail_1.png)
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For NOG (Source: Uniprot.org, NCBI)
Gene Name
NOG
Full Name
Noggin
Weight
Superfamily
noggin family
Alternative Names
NOG; Noggin; SYM1; symphalangism 1 (proximal); synostoses (multiple) syndrome 1; SYNS1; SYNS1A NOG SYM1, SYNS1, SYNS1A noggin noggin|symphalangism 1 (proximal)
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on NOG, check out the NOG Infographic
![NOG infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NOG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Noggin Mouse Recombinant Protein (PROTP97466)
Hello CJ!
No publications found for PROTP97466
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Noggin Mouse Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Noggin Mouse Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question