Nkx3.1 (NKX3-1) (NM_006167) Human Recombinant Protein

NKX3.1 protein,

Product Info Summary

SKU: PROTQ99801
Size: 20 µg
Source: HEK293T

Product Name

Nkx3.1 (NKX3-1) (NM_006167) Human Recombinant Protein

View all NKX3.1 recombinant proteins

SKU/Catalog Number

PROTQ99801

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human NK3 homeobox 1 (NKX3-1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Nkx3.1 (NKX3-1) (NM_006167) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99801)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26.2 kDa

Amino Acid Sequence

MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW

Validation Images & Assay Conditions

Gene/Protein Information For NKX3-1 (Source: Uniprot.org, NCBI)

Gene Name

NKX3-1

Full Name

Homeobox protein Nkx-3.1

Weight

26.2 kDa

Superfamily

NK-3 homeobox family

Alternative Names

BAPX2; BAPX2homeobox protein Nkx-3.1; Homeobox protein NK-3 homolog A; NK homeobox (Drosophila), family 3, A; NK3 homeobox 1; NK3 transcription factor homolog A; NK3 transcription factor related, locus 1 (Drosophila); NK3 transcription factor related, locus 1; NKX3.1; NKX3.1NKX3; NKX3-1; NKX3A; NKX3ANK homeobox, family 3, A NKX3-1 BAPX2, NKX3, NKX3.1, NKX3A NK3 homeobox 1 homeobox protein Nkx-3.1|NK homeobox, family 3, A|NK3 transcription factor homolog A|NK3 transcription factor related, locus 1|homeobox protein NK-3 homolog A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NKX3-1, check out the NKX3-1 Infographic

NKX3-1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NKX3-1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99801

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Nkx3.1 (NKX3-1) (NM_006167) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Nkx3.1 (NKX3-1) (NM_006167) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Nkx3.1 (NKX3-1) (NM_006167) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99801
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.