NIP7 (NM_016101) Human Recombinant Protein

NIP7 protein,

Product Info Summary

SKU: PROTQ9Y221
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NIP7 (NM_016101) Human Recombinant Protein

View all NIP7 recombinant proteins

SKU/Catalog Number

PROTQ9Y221

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nuclear import 7 homolog (S. cerevisiae) (NIP7)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NIP7 (NM_016101) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y221)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.3 kDa

Amino Acid Sequence

MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT

Validation Images & Assay Conditions

Gene/Protein Information For NIP7 (Source: Uniprot.org, NCBI)

Gene Name

NIP7

Full Name

60S ribosome subunit biogenesis protein NIP7 homolog

Weight

20.3 kDa

Superfamily

NIP7 family

Alternative Names

CGI-37,60S ribosome subunit biogenesis protein NIP7 homolog; HSPC031; KD93FLJ10296; nuclear import 7 homolog (S. cerevisiae) NIP7 CGI-37, HSPC031, KD93 nucleolar pre-rRNA processing protein NIP7 60S ribosome subunit biogenesis protein NIP7 homolog|NIP7, nucleolar pre-rRNA processing protein|nuclear import 7 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NIP7, check out the NIP7 Infographic

NIP7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NIP7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y221

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NIP7 (NM_016101) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NIP7 (NM_016101) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NIP7 (NM_016101) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y221
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.