NHP2L1 (SNU13) (NM_001003796) Human Recombinant Protein

SNU13 protein,

Product Info Summary

SKU: PROTP55769
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NHP2L1 (SNU13) (NM_001003796) Human Recombinant Protein

View all SNU13 recombinant proteins

SKU/Catalog Number

PROTP55769

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NHP2L1 (SNU13) (NM_001003796) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP55769)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14 kDa

Amino Acid Sequence

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

Validation Images & Assay Conditions

Gene/Protein Information For SNU13 (Source: Uniprot.org, NCBI)

Gene Name

SNU13

Full Name

NHP2-like protein 1

Weight

14 kDa

Superfamily

eukaryotic ribosomal protein eL8 family

Alternative Names

NHP2-like protein 1 SNU13 15.5K, FA-1, FA1, NHP2L1, NHPX, OTK27, SNRNP15-5, SPAG12, SSFA1 small nuclear ribonucleoprotein 13 NHP2-like protein 1|NHP2 non-histone chromosome protein 2-like 1|SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5)|U4/U6.U5 tri-snRNP 15.5 kDa protein|[U4/U6.U5] tri-snRNP 15.5 kD RNA binding protein|high mobility group-like nuclear protein 2 homolog 1|non-histone chromosome protein 2-like 1|sperm specific 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SNU13, check out the SNU13 Infographic

SNU13 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SNU13: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP55769

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NHP2L1 (SNU13) (NM_001003796) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NHP2L1 (SNU13) (NM_001003796) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NHP2L1 (SNU13) (NM_001003796) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP55769
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.