Neugrin (NGRN) (NM_016645) Human Recombinant Protein

NGRN protein,

Purified recombinant protein of Homo sapiens neugrin, neurite outgrowth associated (NGRN), transcript variant 1

Product Info Summary

SKU: PROTQ9NPE2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Neugrin (NGRN) (NM_016645) Human Recombinant Protein

View all NGRN recombinant proteins

SKU/Catalog Number

PROTQ9NPE2

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens neugrin, neurite outgrowth associated (NGRN), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Neugrin (NGRN) (NM_016645) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NPE2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.2 kDa

Amino Acid Sequence

MEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKVLKKAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGRNKEIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFDSNGNFLYRI

Validation Images & Assay Conditions

Gene/Protein Information For NGRN (Source: Uniprot.org, NCBI)

Gene Name

NGRN

Full Name

Neugrin

Weight

24.2 kDa

Superfamily

neugrin family

Alternative Names

DSC92; FI58G; Mesenchymal stem cell protein DSC92; Neugrin; neugrin, neurite outgrowth associated; neurite outgrowth associated protein; Neurite outgrowth-associated protein; NGRN; Spinal cord-derived protein FI58G NGRN DSC92 neugrin, neurite outgrowth associated neugrin|mesenchymal stem cell protein DSC92|neurite outgrowth associated protein|spinal cord-derived protein FI58G

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NGRN, check out the NGRN Infographic

NGRN infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NGRN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NPE2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Neugrin (NGRN) (NM_016645) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Neugrin (NGRN) (NM_016645) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Neugrin (NGRN) (NM_016645) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NPE2
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.