NEIL2 (NM_001135746) Human Recombinant Protein

NEIL2 protein,

Product Info Summary

SKU: PROTQ969S2
Size: 20 µg
Source: HEK293T

Product Name

NEIL2 (NM_001135746) Human Recombinant Protein

View all NEIL2 recombinant proteins

SKU/Catalog Number

PROTQ969S2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nei like 2 (E. coli) (NEIL2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NEIL2 (NM_001135746) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ969S2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.6 kDa

Amino Acid Sequence

MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For NEIL2 (Source: Uniprot.org, NCBI)

Gene Name

NEIL2

Full Name

Endonuclease 8-like 2

Weight

36.6 kDa

Superfamily

FPG family

Alternative Names

DNA glycosylase/AP lyase Neil2; EC 3.2.2.-; EC 4.2.99.18; endonuclease 8-like 2; Endonuclease VIII-like 2; FLJ31644; MGC2832; MGC4505; NEH2DNA-(apurinic or apyrimidinic site) lyase Neil2; nei endonuclease VIII-like 2 (E. coli); Nei homolog 2; nei like 2 (E. coli); nei like 2; NEI2; Nei-like protein 2 NEIL2 NEH2, NEI2 nei like DNA glycosylase 2 endonuclease 8-like 2|DNA glycosylase/AP lyase Neil2|DNA-(apurinic or apyrimidinic site) lyase Neil2|nei endonuclease VIII-like 2|nei homolog 2|nei-like protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NEIL2, check out the NEIL2 Infographic

NEIL2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NEIL2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ969S2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NEIL2 (NM_001135746) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NEIL2 (NM_001135746) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NEIL2 (NM_001135746) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ969S2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.