NDUFV2 (NM_021074) Human Recombinant Protein

NDUFV2 protein,

Product Info Summary

SKU: PROTP19404
Size: 20 µg
Source: HEK293T

Product Name

NDUFV2 (NM_021074) Human Recombinant Protein

View all NDUFV2 recombinant proteins

SKU/Catalog Number

PROTP19404

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa (NDUFV2), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NDUFV2 (NM_021074) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP19404)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.7 kDa

Amino Acid Sequence

MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL

Validation Images & Assay Conditions

Gene/Protein Information For NDUFV2 (Source: Uniprot.org, NCBI)

Gene Name

NDUFV2

Full Name

NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

Weight

23.7 kDa

Superfamily

complex I 24 kDa subunit family

Alternative Names

CI-24k; mitochondrial respitory chain, 24 kD subunit; NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD); NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa; NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NADH dehydrogenase ubiquinone flavoprotein 2, mitochondrial; NADH-ubiquinone oxidoreductase 24 kDa subunit; NADH-ubiquinone oxidoreductase flavoprotein 2; nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit NDUFV2 CI-24k, MC1DN7 NADH:ubiquinone oxidoreductase core subunit V2 NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial|NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa|NADH dehydrogenase ubiquinone flavoprotein 2, mitochondrial|NADH-ubiquinone oxidoreductase 24 kDa subunit|NADH-ubiquinone oxidoreductase flavoprotein 2|complex I 24kDa subunit|complex I, mitochondrial respitory chain, 24 kD subunit|nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NDUFV2, check out the NDUFV2 Infographic

NDUFV2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NDUFV2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP19404

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NDUFV2 (NM_021074) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NDUFV2 (NM_021074) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NDUFV2 (NM_021074) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP19404
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.