NDUFS6 (NM_004553) Human Recombinant Protein

NDUFS6 protein,

Product Info Summary

SKU: PROTO75380
Size: 20 µg
Source: HEK293T

Product Name

NDUFS6 (NM_004553) Human Recombinant Protein

View all NDUFS6 recombinant proteins

SKU/Catalog Number

PROTO75380

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase) (NDUFS6)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NDUFS6 (NM_004553) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75380)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.8 kDa

Amino Acid Sequence

MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH

Validation Images & Assay Conditions

Gene/Protein Information For NDUFS6 (Source: Uniprot.org, NCBI)

Gene Name

NDUFS6

Full Name

NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial

Weight

10.8 kDa

Superfamily

complex I NDUFS6 subunit family

Alternative Names

CI13KDA; Complex I-13kD-A; mitochondrial respiratory chain, 13-kD subunit; NADH dehydrogenase (ubiquinone) Fe-S protein 6 (13kD) (NADH-coenzyme Qreductase); NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Qreductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial; NADH:ubiquinone oxidoreductase NDUFS6 subunit; NADH-ubiquinone oxidoreductase 13 kDa-A subunit NDUFS6 CI-13kA, CI-13kD-A, CI13KDA, MC1DN9 NADH:ubiquinone oxidoreductase subunit S6 NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial|NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase)|NADH-ubiquinone oxidoreductase 13 kDa-A subunit|NADH:ubiquinone oxidoreductase NDUFS6 subunit|complex I 13kDa subunit A|complex I, mitochondrial respiratory chain, 13-kD subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NDUFS6, check out the NDUFS6 Infographic

NDUFS6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NDUFS6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75380

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NDUFS6 (NM_004553) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NDUFS6 (NM_004553) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NDUFS6 (NM_004553) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75380
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.