NDUFB7 (NM_004146) Human Recombinant Protein

NDUFB7 protein,

Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa (NDUFB7), nuclear gene encoding mitochondrial protein

Product Info Summary

SKU: PROTP17568
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NDUFB7 (NM_004146) Human Recombinant Protein

View all NDUFB7 recombinant proteins

SKU/Catalog Number

PROTP17568

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa (NDUFB7), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NDUFB7 (NM_004146) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP17568)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.2 kDa

Amino Acid Sequence

MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL

Validation Images & Assay Conditions

Gene/Protein Information For NDUFB7 (Source: Uniprot.org, NCBI)

Gene Name

NDUFB7

Full Name

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

Weight

16.2 kDa

Superfamily

complex I NDUFB7 subunit family

Alternative Names

B18; Cell adhesion protein SQM1; CI-B18NADH-ubiquinone oxidoreductase B18 subunit; complex I B18 subunit; Complex I-B18; MGC2480; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7 (18kD, B18); NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 NDUFB7 B18, CI-B18 NADH:ubiquinone oxidoreductase subunit B7 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7|NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa|NADH-ubiquinone oxidoreductase B18 subunit|cell adhesion protein SQM1|complex I B18 subunit|complex I-B18

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NDUFB7, check out the NDUFB7 Infographic

NDUFB7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NDUFB7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP17568

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NDUFB7 (NM_004146) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NDUFB7 (NM_004146) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NDUFB7 (NM_004146) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP17568
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.