NAT13 (NAA50) (NM_025146) Human Recombinant Protein

NAT13 protein,

Product Info Summary

SKU: PROTQ9GZZ1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NAT13 (NAA50) (NM_025146) Human Recombinant Protein

View all NAT13 recombinant proteins

SKU/Catalog Number

PROTQ9GZZ1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human N-acetyltransferase 13 (GCN5-related) (NAT13)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NAT13 (NAA50) (NM_025146) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9GZZ1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.2 kDa

Amino Acid Sequence

MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN

Validation Images & Assay Conditions

Gene/Protein Information For NAA50 (Source: Uniprot.org, NCBI)

Gene Name

NAA50

Full Name

N-alpha-acetyltransferase 50

Weight

19.2 kDa

Superfamily

acetyltransferase family

Alternative Names

EC 2.3.1.-; FLJ13194; hSAN; Mak3 homolog (S. cerevisiae); N(alpha)-acetyltransferase 50, NatE catalytic subunit; N-acetyltransferase 13 (GCN5-related); N-acetyltransferase 5; N-acetyltransferase san homolog; NAT13San; NAT5SAN; NatE catalytic subunit; separation anxiety

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NAA50, check out the NAA50 Infographic

NAA50 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NAA50: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9GZZ1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NAT13 (NAA50) (NM_025146) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NAT13 (NAA50) (NM_025146) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NAT13 (NAA50) (NM_025146) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9GZZ1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.