NARS1 (NM_004539) Human Recombinant Protein

NARS1 protein,

Product Info Summary

SKU: PROTO43776
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NARS1 (NM_004539) Human Recombinant Protein

View all NARS1 recombinant proteins

SKU/Catalog Number

PROTO43776

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human asparaginyl-tRNA synthetase (NARS)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NARS1 (NM_004539) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43776)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

62.8 kDa

Amino Acid Sequence

MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP

Validation Images & Assay Conditions

Gene/Protein Information For NARS1 (Source: Uniprot.org, NCBI)

Gene Name

NARS1

Full Name

Asparagine--tRNA ligase, cytoplasmic

Weight

62.8 kDa

Superfamily

class-II aminoacyl-tRNA synthetase family

Alternative Names

Asparagine--tRNA ligase, cytoplasmic NARS1 ASNRS, NARS, NEDMILEG, NEDMILG asparaginyl-tRNA synthetase 1 asparagine--tRNA ligase, cytoplasmic|asparagine tRNA ligase 1, cytoplasmic|asparaginyl-tRNA synthetase, cytoplasmic

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NARS1, check out the NARS1 Infographic

NARS1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NARS1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43776

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NARS1 (NM_004539) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NARS1 (NM_004539) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NARS1 (NM_004539) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43776
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.