NAP1L1 (NM_004537) Human Recombinant Protein

NAP1L1 protein,

Product Info Summary

SKU: PROTP55209
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NAP1L1 (NM_004537) Human Recombinant Protein

View all NAP1L1 recombinant proteins

SKU/Catalog Number

PROTP55209

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NAP1L1 (NM_004537) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP55209)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

45.2 kDa

Amino Acid Sequence

MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ

Validation Images & Assay Conditions

Gene/Protein Information For NAP1L1 (Source: Uniprot.org, NCBI)

Gene Name

NAP1L1

Full Name

Nucleosome assembly protein 1-like 1

Weight

45.2 kDa

Superfamily

nucleosome assembly protein (NAP) family

Alternative Names

hNRP; HSP22-like protein interacting protein; MGC23410; MGC8688; NAP-1 related protein; NAP1; NAP1LFLJ16112; NRPNAP-1-related protein; nucleosome assembly protein 1-like 1 NAP1L1 NAP1, NAP1L, NRP nucleosome assembly protein 1 like 1 nucleosome assembly protein 1-like 1|HSP22-like protein interacting protein|NAP-1-related protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NAP1L1, check out the NAP1L1 Infographic

NAP1L1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NAP1L1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP55209

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NAP1L1 (NM_004537) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NAP1L1 (NM_004537) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NAP1L1 (NM_004537) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP55209
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.