NANS (NM_018946) Human Recombinant Protein

NANS protein,

Product Info Summary

SKU: PROTQ9NR45
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NANS (NM_018946) Human Recombinant Protein

View all NANS recombinant proteins

SKU/Catalog Number

PROTQ9NR45

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human N-acetylneuraminic acid synthase (NANS)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NANS (NM_018946) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NR45)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

40.1 kDa

Amino Acid Sequence

MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS

Validation Images & Assay Conditions

Gene/Protein Information For NANS (Source: Uniprot.org, NCBI)

Gene Name

NANS

Full Name

Sialic acid synthase

Weight

40.1 kDa

Alternative Names

EC 2.5.1.56; EC 2.5.1.57; N-acetylneuraminate synthase; N-acetylneuraminate-9-phosphate synthase; N-acetylneuraminic acid phosphate synthase; N-acetylneuraminic acid synthasesialic acid phosphate synthase; SASsialic acid synthase NANS HEL-S-100, SAS, SEMDCG, SEMDG N-acetylneuraminate synthase sialic acid synthase|N-acetylneuraminate-9-phosphate synthase|N-acetylneuraminic acid phosphate synthase|N-acetylneuraminic acid synthase|epididymis secretory protein Li 100|sialic acid phosphate synthase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NANS, check out the NANS Infographic

NANS infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NANS: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NR45

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NANS (NM_018946) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NANS (NM_018946) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NANS (NM_018946) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NR45
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.